SCOPe 2.08: Domain d6iejb1: 6iej B:16-140

Lineage for d6iejb1 (6iej B:16-140)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families)
   two constituent families are related by circular permutation

5. Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)

6. Protein automated matches [190564] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [369124] (1 PDB entry)

8. Domain d6iejb1: 6iej B:16-140 [369145]
   Other proteins in same PDB: d6ieja2, d6iejb2, d6iejc2
   automated match to d1rlwa_
   complexed with ca, hxg, mg

Details for d6iejb1

PDB Entry: 6iej, 2.21 Å

PDB Description: the c2 domain of cytosolic phospholipase a2 alpha bound to phosphatidylcholine

PDB Compounds: (B:) cytosolic phospholipase a2

SCOPe Domain Sequences for d6iejb1:

Sequence; same for both SEQRES and ATOM records:

>d6iejb1 b.7.1.1 (B:16-140) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
yshvftvtvrkatnvtkgaigdmldtpdpyvelfipsapdcrkrtkhfnndvnpvwnetf
efildpnqdnvlevtlmdanyvmdetlgmatfpisslklgekkevqltfnnvtemtlels
levcs

Timeline for d6iejb1:

• d6iejb1 first appeared in SCOPe 2.07