Lineage for d6iejc1 (6iej C:16-140)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772796Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2772932Protein automated matches [190564] (3 species)
    not a true protein
  7. 2772933Species Chicken (Gallus gallus) [TaxId:9031] [369124] (1 PDB entry)
  8. 2772936Domain d6iejc1: 6iej C:16-140 [369161]
    Other proteins in same PDB: d6ieja2, d6iejb2, d6iejc2
    automated match to d1rlwa_
    complexed with ca, hxg, mg

Details for d6iejc1

PDB Entry: 6iej (more details), 2.21 Å

PDB Description: the c2 domain of cytosolic phospholipase a2 alpha bound to phosphatidylcholine
PDB Compounds: (C:) cytosolic phospholipase a2

SCOPe Domain Sequences for d6iejc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iejc1 b.7.1.1 (C:16-140) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
yshvftvtvrkatnvtkgaigdmldtpdpyvelfipsapdcrkrtkhfnndvnpvwnetf
efildpnqdnvlevtlmdanyvmdetlgmatfpisslklgekkevqltfnnvtemtlels
levcs

SCOPe Domain Coordinates for d6iejc1:

Click to download the PDB-style file with coordinates for d6iejc1.
(The format of our PDB-style files is described here.)

Timeline for d6iejc1: