SCOPe 2.08: Domain d6j36a2: 6j36 A:142-451

Lineage for d6j36a2 (6j36 A:142-451)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.1: Enolase [51605] (2 proteins)
   automatically mapped to Pfam PF00113

6. Protein Enolase [51606] (11 species)
   Fold of this protein slightly differs from common fold in topology

7. Species Mycoplasma hyopneumoniae [TaxId:2099] [419772] (1 PDB entry)

8. Domain d6j36a2: 6j36 A:142-451 [368855]
   Other proteins in same PDB: d6j36a1, d6j36a3, d6j36b1, d6j36b3
   automated match to d4ewja2
   complexed with gol, so4

Details for d6j36a2

PDB Entry: 6j36, 2.3 Å

PDB Description: crystal structure of mycoplasma hyopneumoniae enolase

PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d6j36a2:

Sequence; same for both SEQRES and ATOM records:

>d6j36a2 c.1.11.1 (A:142-451) Enolase {Mycoplasma hyopneumoniae [TaxId: 2099]}
nptlmpvpmlnvinggehasntldfqefmimplgfrtfkealqaankvfhnlakllkksg
fetqvgdeggfapnfnsheqaldflvdaikesgfnpgfkgenavaiaidaaasefyngqk
yvfkklkaaslsknqadldekfefnseellnyygqllakypiisiedgfaesdwqgfiaf
nqkygnnhqivgddltvtnveilkkainlkainsiliklnqigtlsetldaihlaqksgm
tavishrsgesedttiadlavavssgqiktgslsrtdriakynrllvieeylnsyakady
igrevfynlk

Timeline for d6j36a2:

• d6j36a2 first appeared in SCOPe 2.07