SCOPe 2.08: Domain d6j36b1: 6j36 B:2-141

Lineage for d6j36b1 (6j36 B:2-141)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Mycoplasma hyopneumoniae [TaxId:2099] [368850] (1 PDB entry)

8. Domain d6j36b1: 6j36 B:2-141 [368851]
   Other proteins in same PDB: d6j36a2, d6j36a3, d6j36b2, d6j36b3
   automated match to d4ewja1
   complexed with gol, so4

Details for d6j36b1

PDB Entry: 6j36, 2.3 Å

PDB Description: crystal structure of mycoplasma hyopneumoniae enolase

PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d6j36b1:

Sequence; same for both SEQRES and ATOM records:

>d6j36b1 d.54.1.0 (B:2-141) automated matches {Mycoplasma hyopneumoniae [TaxId: 2099]}
skitkvfareildsrgnptiqvdvytlaggfgsaivpsgastgsrealelrdtntkyadn
wygqkgvmtavdnvnniiapeiiglccknqrlidqkiieldgtpnkeklganailgvsla
vakaaanelrmplfrylggt

Timeline for d6j36b1:

• d6j36b1 first appeared in SCOPe 2.07