Lineage for d6j36b1 (6j36 B:2-141)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948362Species Mycoplasma hyopneumoniae [TaxId:2099] [368850] (1 PDB entry)
  8. 2948364Domain d6j36b1: 6j36 B:2-141 [368851]
    Other proteins in same PDB: d6j36a2, d6j36a3, d6j36b2, d6j36b3
    automated match to d4ewja1
    complexed with gol, so4

Details for d6j36b1

PDB Entry: 6j36 (more details), 2.3 Å

PDB Description: crystal structure of mycoplasma hyopneumoniae enolase
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d6j36b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j36b1 d.54.1.0 (B:2-141) automated matches {Mycoplasma hyopneumoniae [TaxId: 2099]}
skitkvfareildsrgnptiqvdvytlaggfgsaivpsgastgsrealelrdtntkyadn
wygqkgvmtavdnvnniiapeiiglccknqrlidqkiieldgtpnkeklganailgvsla
vakaaanelrmplfrylggt

SCOPe Domain Coordinates for d6j36b1:

Click to download the PDB-style file with coordinates for d6j36b1.
(The format of our PDB-style files is described here.)

Timeline for d6j36b1: