SCOPe 2.08: Domain d6i5pg1: 6i5p G:28-166

Lineage for d6i5pg1 (6i5p G:28-166)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.1: MATH domain [49600] (5 proteins)
   automatically mapped to Pfam PF00917

6. Protein Speckle-type poz protein SPOP [141107] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141108] (16 PDB entries)
   Uniprot O43791 28-173

8. Domain d6i5pg1: 6i5p G:28-166 [368556]
   Other proteins in same PDB: d6i5pg2
   automated match to d3hqma_

Details for d6i5pg1

PDB Entry: 6i5p, 1.81 Å

PDB Description: co-crystal structure of human spop math domain (e47k) and human brd3 fragment

PDB Compounds: (G:) Speckle-type POZ protein

SCOPe Domain Sequences for d6i5pg1:

Sequence; same for both SEQRES and ATOM records:

>d6i5pg1 b.8.1.1 (G:28-166) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]}
kvvkfsymwtinnfsfcrekmgeviksstfssgandklkwclrvnpkgldeeskdylsly
lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldean
gllpddkltlfcevsvvqd

Timeline for d6i5pg1:

• d6i5pg1 first appeared in SCOPe 2.07