Class b: All beta proteins [48724] (180 folds) |
Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (3 families) has a circularly permuted immunoglobulin-fold topology with extra strand |
Family b.8.1.1: MATH domain [49600] (5 proteins) automatically mapped to Pfam PF00917 |
Protein Speckle-type poz protein SPOP [141107] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141108] (16 PDB entries) Uniprot O43791 28-173 |
Domain d6i5pe_: 6i5p E: [368569] Other proteins in same PDB: d6i5pg2 automated match to d3hqma_ |
PDB Entry: 6i5p (more details), 1.81 Å
SCOPe Domain Sequences for d6i5pe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i5pe_ b.8.1.1 (E:) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} kvvkfsymwtinnfsfcrekmgeviksstfssgandklkwclrvnpkgldeeskdylsly lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldean gllpddkltlfcevsvvq
Timeline for d6i5pe_:
View in 3D Domains from other chains: (mouse over for more information) d6i5pa_, d6i5pc_, d6i5pg1, d6i5pg2 |