Lineage for d6i5pc_ (6i5p C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773292Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773293Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2773294Family b.8.1.1: MATH domain [49600] (5 proteins)
    automatically mapped to Pfam PF00917
  6. 2773295Protein Speckle-type poz protein SPOP [141107] (1 species)
  7. 2773296Species Human (Homo sapiens) [TaxId:9606] [141108] (16 PDB entries)
    Uniprot O43791 28-173
  8. 2773311Domain d6i5pc_: 6i5p C: [368573]
    Other proteins in same PDB: d6i5pg2
    automated match to d3hqma_

Details for d6i5pc_

PDB Entry: 6i5p (more details), 1.81 Å

PDB Description: co-crystal structure of human spop math domain (e47k) and human brd3 fragment
PDB Compounds: (C:) Speckle-type POZ protein

SCOPe Domain Sequences for d6i5pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i5pc_ b.8.1.1 (C:) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]}
kvvkfsymwtinnfsfcrekmgeviksstfssgandklkwclrvnpkgldeeskdylsly
lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldean
gllpddkltlfcevsvvq

SCOPe Domain Coordinates for d6i5pc_:

Click to download the PDB-style file with coordinates for d6i5pc_.
(The format of our PDB-style files is described here.)

Timeline for d6i5pc_: