SCOPe 2.07: Domain d6i9ya_: 6i9y A:

Lineage for d6i9ya_ (6i9y A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
   automatically mapped to Pfam PF00547

6. Protein automated matches [279671] (2 species)
   not a true protein

7. Species Sporosarcina pasteurii [TaxId:1474] [279673] (11 PDB entries)

8. Domain d6i9ya_: 6i9y A: [368397]
   Other proteins in same PDB: d6i9yb_
   automated match to d5g4ha_
   complexed with au, edo, ni, oh, so4

Details for d6i9ya_

PDB Entry: 6i9y, 2.14 Å

PDB Description: the 2.14 a x-ray crystal structure of sporosarcina pasteurii urease in complex with au(i) ions

PDB Compounds: (A:) Urease subunit gamma

SCOPe Domain Sequences for d6i9ya_:

Sequence; same for both SEQRES and ATOM records:

>d6i9ya_ d.8.1.1 (A:) automated matches {Sporosarcina pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

Timeline for d6i9ya_:

• d6i9ya_ is new in SCOPe 2.07-stable
  
• d6i9ya_ appears in the current release, SCOPe 2.08