Lineage for d6d8ra_ (6d8r A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030578Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 3030705Protein automated matches [197331] (11 species)
    not a true protein
  7. 3030741Species Mesobuthus tamulus [TaxId:34647] [255376] (18 PDB entries)
  8. 3030745Domain d6d8ra_: 6d8r A: [368362]
    automated match to d2lu9a_
    mutant

Details for d6d8ra_

PDB Entry: 6d8r (more details)

PDB Description: nmr solution structure of tamapin, mutant e25k
PDB Compounds: (A:) Potassium channel toxin alpha-KTx 5.4

SCOPe Domain Sequences for d6d8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d8ra_ g.3.7.2 (A:) automated matches {Mesobuthus tamulus [TaxId: 34647]}
afcnlrrcelscrslgllgkcigekckcvpy

SCOPe Domain Coordinates for d6d8ra_:

Click to download the PDB-style file with coordinates for d6d8ra_.
(The format of our PDB-style files is described here.)

Timeline for d6d8ra_: