Lineage for d6qm7s_ (6qm7 S:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2996436Species Leishmania tarentolae [TaxId:5689] [367902] (1 PDB entry)
  8. 2996452Domain d6qm7s_: 6qm7 S: [367927]
    automated match to d4g4se_
    complexed with j6e

Details for d6qm7s_

PDB Entry: 6qm7 (more details), 2.8 Å

PDB Description: leishmania tarentolae proteasome 20s subunit complexed with gsk3494245
PDB Compounds: (S:) Proteasome alpha5 chain

SCOPe Domain Sequences for d6qm7s_:

Sequence, based on SEQRES records: (download)

>d6qm7s_ d.153.1.0 (S:) automated matches {Leishmania tarentolae [TaxId: 5689]}
eydrgvntfspegrifqieyaveaiklgstslgirtpegvvlaaekrvpstlvvpssmsk
imevdshiaavmsgmvadarilveharvesqnhrftynepmsvesctlatcdlsiqfges
ggrrklmsrpfgvslliagvdekgpqlwqtdpsgthtrydaqaigggaeaaqsvfteryh
rnmtleegetlavdilkqvmedqlspenievavvraddgklhmytpteikaimsrm

Sequence, based on observed residues (ATOM records): (download)

>d6qm7s_ d.153.1.0 (S:) automated matches {Leishmania tarentolae [TaxId: 5689]}
eydrgvntfspegrifqieyaveaiklgstslgirtpegvvlaaekrvpstlvvpssmsk
imevdshiaavmsgmvadarilveharvesqnhrftynepmsvesctlatcdlsiqfglm
srpfgvslliagvdekgpqlwqtdpsgthtrydaqaigggaeaaqsvfteryhrnmtlee
getlavdilkqvmedqlspenievavvraddgklhmytpteikaimsrm

SCOPe Domain Coordinates for d6qm7s_:

Click to download the PDB-style file with coordinates for d6qm7s_.
(The format of our PDB-style files is described here.)

Timeline for d6qm7s_: