Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Leishmania tarentolae [TaxId:5689] [367902] (1 PDB entry) |
Domain d6qm7i_: 6qm7 I: [367904] automated match to d5fgih_ complexed with j6e |
PDB Entry: 6qm7 (more details), 2.8 Å
SCOPe Domain Sequences for d6qm7i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qm7i_ d.153.1.0 (I:) automated matches {Leishmania tarentolae [TaxId: 5689]} ttivgvvyrdgvvlgadtrategsivadkrcrkihymapnimccgagtsadteavtnmvs shlalhrletgkqsrvlealtllkrhlyryqghvsaalvlggvdvegpflatiaphgstd rlpfvtmgsgsiaamaqleaaykdnmtceeakelvasairkgifndpysgtqvdvcvitk dkteltigydkpnermyprqevllppgttpvlkeeirql
Timeline for d6qm7i_: