Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (36 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [323630] (11 PDB entries) |
Domain d6hxgf_: 6hxg F: [367818] automated match to d5lnsd_ complexed with so4 |
PDB Entry: 6hxg (more details), 1.9 Å
SCOPe Domain Sequences for d6hxgf_:
Sequence, based on SEQRES records: (download)
>d6hxgf_ c.1.2.0 (F:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdp qmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfrip fvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevft fakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgdp arraraivqavthysdpemlvevscglgea
>d6hxgf_ c.1.2.0 (F:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalegvarmsdpqmikeikqav tipvmakarighfveaqileaigidyidesevltladedhhinkhnfripfvcgcrnlge alrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevftfakklaapyd lvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvggdparraraivqavthysd pemlvevscglgea
Timeline for d6hxgf_: