SCOPe 2.07: Domain d6q4ra3: 6q4r A:530-614

Lineage for d6q4ra3 (6q4r A:530-614)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families)
   same topology as (b.1.15.1)

5. Family b.1.30.0: automated matches [254306] (1 protein)
   not a true family

6. Protein automated matches [254707] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries)

8. Domain d6q4ra3: 6q4r A:530-614 [367592]
   Other proteins in same PDB: d6q4ra1, d6q4ra2, d6q4ra4
   automated match to d2xdta3
   complexed with b3p, bma, edo, hj5, mlt, na, nag, p6g, pg4, zn

Details for d6q4ra3

PDB Entry: 6q4r, 1.6 Å

PDB Description: high-resolution crystal structure of erap1 with bound phosphinic transition-state analogue inhibitor

PDB Compounds: (A:) Endoplasmic reticulum aminopeptidase 1,Endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d6q4ra3:

Sequence, based on SEQRES records:

>d6q4ra3 b.1.30.0 (A:530-614) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktktdvl
ilpeevewikfnvgmngyyivhyed

Sequence, based on observed residues (ATOM records):

>d6q4ra3 b.1.30.0 (A:530-614) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymkgdtgylwhvpltfitsksdmvhrfllktktdvlilpee
vewikfnvgmngyyivhyed

Timeline for d6q4ra3:

• d6q4ra3 is new in SCOPe 2.07-stable
  
• d6q4ra3 appears in the current release, SCOPe 2.08