SCOPe 2.07: Domain d6q4ra1: 6q4r A:45-254

Lineage for d6q4ra1 (6q4r A:45-254)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.0: automated matches [254305] (1 protein)
   not a true family

6. Protein automated matches [254706] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)

8. Domain d6q4ra1: 6q4r A:45-254 [367590]
   Other proteins in same PDB: d6q4ra2, d6q4ra3, d6q4ra4
   automated match to d2xdta1
   complexed with b3p, bma, edo, hj5, mlt, na, nag, p6g, pg4, zn

Details for d6q4ra1

PDB Entry: 6q4r, 1.6 Å

PDB Description: high-resolution crystal structure of erap1 with bound phosphinic transition-state analogue inhibitor

PDB Compounds: (A:) Endoplasmic reticulum aminopeptidase 1,Endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d6q4ra1:

Sequence, based on SEQRES records:

>d6q4ra1 b.98.1.0 (A:45-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisr
atlrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfyk
styrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvks
vtvaegliedhfdvtvkmstylvafiisdf

Sequence, based on observed residues (ATOM records):

>d6q4ra1 b.98.1.0 (A:45-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisr
atlrkrlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyr
tkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtva
egliedhfdvtvkmstylvafiisdf

Timeline for d6q4ra1:

• d6q4ra1 is new in SCOPe 2.07-stable
  
• d6q4ra1 appears in the current release, SCOPe 2.08