SCOPe 2.08: Domain d6cx9a1: 6cx9 A:7-185

Lineage for d6cx9a1 (6cx9 A:7-185)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d6cx9a1: 6cx9 A:7-185 [367355]
   Other proteins in same PDB: d6cx9a2, d6cx9b_, d6cx9c1, d6cx9c2, d6cx9d1, d6cx9d2
   automated match to d1zt4c2
   complexed with em4, na, nag

Details for d6cx9a1

PDB Entry: 6cx9, 2.36 Å

PDB Description: structure of alpha-gsa[16,6p] bound by cd1d and in complex with the va14vb8.2 tcr

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6cx9a1:

Sequence; same for both SEQRES and ATOM records:

>d6cx9a1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d6cx9a1:

• d6cx9a1 first appeared in SCOPe 2.07