SCOPe 2.08: Domain d6cx9c1: 6cx9 C:2-115

Lineage for d6cx9c1 (6cx9 C:2-115)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6cx9c1: 6cx9 C:2-115 [367370]
   Other proteins in same PDB: d6cx9a1, d6cx9b_, d6cx9c2
   automated match to d2pyfa1
   complexed with em4, na, nag

Details for d6cx9c1

PDB Entry: 6cx9, 2.36 Å

PDB Description: structure of alpha-gsa[16,6p] bound by cd1d and in complex with the va14vb8.2 tcr

PDB Compounds: (C:) Chimeric T cell antigen receptor alpha chain Va14,Va24,Ja18

SCOPe Domain Sequences for d6cx9c1:

Sequence; same for both SEQRES and ATOM records:

>d6cx9c1 b.1.1.0 (C:2-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d6cx9c1:

• d6cx9c1 first appeared in SCOPe 2.07