SCOPe 2.08: Domain d6n4ea1: 6n4e A:1-75

Lineage for d6n4ea1 (6n4e A:1-75)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class sigma GST [81362] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89705] (16 PDB entries)
   Uniprot O60760
   synonym: hematopoietic prostaglandin D synthase

8. Domain d6n4ea1: 6n4e A:1-75 [366912]
   Other proteins in same PDB: d6n4ea2
   automated match to d1pd212
   complexed with gsh, kcd

Details for d6n4ea1

PDB Entry: 6n4e, 1.65 Å

PDB Description: hpgds complexed with a quinoline-3-carboxamide

PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d6n4ea1:

Sequence; same for both SEQRES and ATOM records:

>d6n4ea1 c.47.1.5 (A:1-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
lhqslaiaryltknt

Timeline for d6n4ea1:

• d6n4ea1 first appeared in SCOPe 2.07