Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [366880] (1 PDB entry) |
Domain d6mjpb_: 6mjp B: [366881] automated match to d4wbsa_ complexed with ae3, ca, cl, gol, ju7, lmt, ma4, peg, pg4 |
PDB Entry: 6mjp (more details), 2.85 Å
SCOPe Domain Sequences for d6mjpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mjpb_ c.37.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]} ailkaqhlaksykkrkvvsdvslqvesgqivgllgpngagkttsfymivglvardegtit iddndisilpmhsrsrmgigylpqeasifrklsvednimavlqtreeltheerqdkledl leefhiqhirksagmalsggerrrveiaralaanpqfilldqpfagvdpisvidikkiie hlrdrglgvlitdhnvretldvcekayivsqgrliaegtpqdvlnneqvkqvylgeqfrl
Timeline for d6mjpb_: