Lineage for d6mjpb_ (6mjp B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2481146Species Vibrio cholerae [TaxId:666] [366880] (1 PDB entry)
  8. 2481148Domain d6mjpb_: 6mjp B: [366881]
    automated match to d4wbsa_
    complexed with ae3, ca, cl, gol, ju7, lmt, ma4, peg, pg4

Details for d6mjpb_

PDB Entry: 6mjp (more details), 2.85 Å

PDB Description: lptb(e163q)fgc from vibrio cholerae
PDB Compounds: (B:) ABC transporter ATP-binding protein

SCOPe Domain Sequences for d6mjpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mjpb_ c.37.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
ailkaqhlaksykkrkvvsdvslqvesgqivgllgpngagkttsfymivglvardegtit
iddndisilpmhsrsrmgigylpqeasifrklsvednimavlqtreeltheerqdkledl
leefhiqhirksagmalsggerrrveiaralaanpqfilldqpfagvdpisvidikkiie
hlrdrglgvlitdhnvretldvcekayivsqgrliaegtpqdvlnneqvkqvylgeqfrl

SCOPe Domain Coordinates for d6mjpb_:

Click to download the PDB-style file with coordinates for d6mjpb_.
(The format of our PDB-style files is described here.)

Timeline for d6mjpb_: