SCOPe 2.08: Domain d6mjpb_: 6mjp B:

Lineage for d6mjpb_ (6mjp B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [366880] (1 PDB entry)

8. Domain d6mjpb_: 6mjp B: [366881]
   automated match to d4wbsa_
   complexed with ae3, ca, cl, gol, ju7, lmt, ma4, peg, pg4

Details for d6mjpb_

PDB Entry: 6mjp, 2.85 Å

PDB Description: lptb(e163q)fgc from vibrio cholerae

PDB Compounds: (B:) ABC transporter ATP-binding protein

SCOPe Domain Sequences for d6mjpb_:

Sequence; same for both SEQRES and ATOM records:

>d6mjpb_ c.37.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
ailkaqhlaksykkrkvvsdvslqvesgqivgllgpngagkttsfymivglvardegtit
iddndisilpmhsrsrmgigylpqeasifrklsvednimavlqtreeltheerqdkledl
leefhiqhirksagmalsggerrrveiaralaanpqfilldqpfagvdpisvidikkiie
hlrdrglgvlitdhnvretldvcekayivsqgrliaegtpqdvlnneqvkqvylgeqfrl

Timeline for d6mjpb_:

• d6mjpb_ first appeared in SCOPe 2.07