Lineage for d6gjoa_ (6gjo A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981559Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (2 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. 2981560Species Human (Homo sapiens) [TaxId:9606] [69824] (57 PDB entries)
    Uniprot P49841 35-383 ! Uniprot P49841 35-384
  8. 2981659Domain d6gjoa_: 6gjo A: [366849]
    automated match to d1q5ka_
    complexed with f1b

Details for d6gjoa_

PDB Entry: 6gjo (more details), 2.91 Å

PDB Description: crystal structure of glycogen synthase kinase-3 beta in complex with bi-91bs
PDB Compounds: (A:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d6gjoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gjoa_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar

SCOPe Domain Coordinates for d6gjoa_:

Click to download the PDB-style file with coordinates for d6gjoa_.
(The format of our PDB-style files is described here.)

Timeline for d6gjoa_: