PDB entry 6gjo

View 6gjo on RCSB PDB site
Description: Crystal Structure of Glycogen Synthase Kinase-3 beta in Complex with BI-91BS
Class: transferase
Keywords: kinase, indolinone, gsk3, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, wnt signaling pathway, transferase
Deposited on 2018-05-16, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gjoa_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gjob_
  • Heterogens: F1B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gjoA (A:)
    ttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngs
    fgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdev
    ylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqn
    llldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcv
    laelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfr
    prtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqe
    lssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gjoA (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gjoB (B:)
    ttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngs
    fgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdev
    ylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqn
    llldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcv
    laelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfr
    prtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqe
    lssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gjoB (B:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssvylnlvldyvpetvyrvarhysrakqtlpviyvkl
    ymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsr
    yyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreq
    iremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsff
    delrdpnvklpngrdtpalfnfttqelssnpplatilipphar