Lineage for d6ftob_ (6fto B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394630Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2394814Family b.34.13.0: automated matches [191621] (1 protein)
    not a true family
  6. 2394815Protein automated matches [191139] (6 species)
    not a true protein
  7. 2394849Species Schizosaccharomyces pombe [TaxId:4896] [366784] (1 PDB entry)
  8. 2394851Domain d6ftob_: 6fto B: [366785]
    automated match to d1e0bb_
    complexed with hez

Details for d6ftob_

PDB Entry: 6fto (more details), 1.6 Å

PDB Description: crystal structure of the chp2 chromoshadow domain in complex with n- terminal domain of chromatin remodeler mit1
PDB Compounds: (B:) Chromo domain-containing protein 2

SCOPe Domain Sequences for d6ftob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ftob_ b.34.13.0 (B:) automated matches {Schizosaccharomyces pombe [TaxId: 4896]}
mkppfqkkswedlvdcvktvqqldngkliakikwkngyvsthdniiihqkcplkiieyye
ahikft

SCOPe Domain Coordinates for d6ftob_:

Click to download the PDB-style file with coordinates for d6ftob_.
(The format of our PDB-style files is described here.)

Timeline for d6ftob_: