Lineage for d1e0bb_ (1e0b B:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.13: Chromo domain-like [54160] (4 families) 
SH3-like barrel is capped by a C-terminal helix
Family b.34.13.2: Chromo domain [54165] (8 proteins)
lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
Protein Heterochromatin protein 1, HP1 [54166] (4 species)
duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain
Species Fission yeast (Schizosaccharomyces pombe), SWI6 [TaxId:4896] [54169] (1 PDB entry) 
Domain d1e0bb_: 1e0b B: [37477]
C-terminal shadow chromo domain
complexed with 1pg
Details for d1e0bb_
PDB Entry: 1e0b (more details), 1.9 Å
PDB Description: chromo shadow domain from fission yeast swi6 protein.
PDB Compounds: (B:) swi6 proteinSCOPe Domain Sequences for d1e0bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0bb_ b.34.13.2 (B:) Heterochromatin protein 1, HP1 {Fission yeast (Schizosaccharomyces pombe), SWI6 [TaxId: 4896]}
ydswedlvssidtierkddgtleiyltwkngaishhpstitnkkcpqkmlqfyeshltf
SCOPe Domain Coordinates for d1e0bb_:
Click to download the PDB-style file with coordinates for d1e0bb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e0bb_:
View in 3D
