Lineage for d6giod_ (6gio D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505229Species Ochrobactrum anthropi [TaxId:529] [366776] (1 PDB entry)
  8. 2505233Domain d6giod_: 6gio D: [366777]
    automated match to d5wyaa_
    complexed with edo, plp

Details for d6giod_

PDB Entry: 6gio (more details), 1.87 Å

PDB Description: structure of amino acid amide racemase from ochrobactrum anthropi
PDB Compounds: (D:) Amino acid amide racemase

SCOPe Domain Sequences for d6giod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6giod_ c.67.1.0 (D:) automated matches {Ochrobactrum anthropi [TaxId: 529]}
lslrerdarviaeigrlrfsplsliggkgnrlieeggrsildlsgsagpaalgyghpaiv
eaveksvrdmagaslllypneaavslaedllritpgngerrvwfghsgsdandcavrvlt
aatkrsriisfigsyhgnltgsmgisghtamthtlprpgvlllpypdpfrprfsaeavle
lldyhfatscppeqvaavfiepilsdgglvvpppaflealqdrcrkhgilvvvdevkvgl
grtglmhcfqheglepdmvvfgkglggglplsavvgpqwvmdhapafvlqttagnpvata
agravlntierqglaqrservggifadrlrrlsdkhsiigdvrgrglaigvdlvsdrgsr
epapvtttakiiyrgyqlgaaftyvglnanvlefmppltltepeideaadivdqaigdvl
dgkvadsdvahfmm

SCOPe Domain Coordinates for d6giod_:

Click to download the PDB-style file with coordinates for d6giod_.
(The format of our PDB-style files is described here.)

Timeline for d6giod_: