Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein automated matches [227005] (6 species) not a true protein |
Species Homo sapiens [TaxId:9606] [353659] (4 PDB entries) |
Domain d6ecqa2: 6ecq A:127-296 [366743] Other proteins in same PDB: d6ecqa1, d6ecqb1, d6ecqb2 automated match to d1a4ia1 complexed with lud, nap |
PDB Entry: 6ecq (more details), 2.7 Å
SCOPe Domain Sequences for d6ecqa2:
Sequence, based on SEQRES records: (download)
>d6ecqa2 c.2.1.7 (A:127-296) automated matches {Homo sapiens [TaxId: 9606]} ltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapmhdlll wnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyvpddkk pngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle
>d6ecqa2 c.2.1.7 (A:127-296) automated matches {Homo sapiens [TaxId: 9606]} ltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapmhdlll wnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyvpkvvg dvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle
Timeline for d6ecqa2: