SCOPe 2.07: Domain d6ecqa2: 6ecq A:127-296

Lineage for d6ecqa2 (6ecq A:127-296)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein automated matches [227005] (6 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [353659] (4 PDB entries)

8. Domain d6ecqa2: 6ecq A:127-296 [366743]
   Other proteins in same PDB: d6ecqa1, d6ecqb1, d6ecqb2
   automated match to d1a4ia1
   complexed with lud, nap

Details for d6ecqa2

PDB Entry: 6ecq, 2.7 Å

PDB Description: the human methylenetetrahydrofolate dehydrogenase/cyclohydrolase (fold) complexed with nadp and inhibitor ly345899

PDB Compounds: (A:) methylenetetrahydrofolate dehydrogenase cyclohydrolase

SCOPe Domain Sequences for d6ecqa2:

Sequence, based on SEQRES records:

>d6ecqa2 c.2.1.7 (A:127-296) automated matches {Homo sapiens [TaxId: 9606]}
ltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapmhdlll
wnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyvpddkk
pngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle

Sequence, based on observed residues (ATOM records):

>d6ecqa2 c.2.1.7 (A:127-296) automated matches {Homo sapiens [TaxId: 9606]}
ltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapmhdlll
wnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyvpkvvg
dvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle

Timeline for d6ecqa2:

• d6ecqa2 is new in SCOPe 2.07-stable
  
• d6ecqa2 appears in the current release, SCOPe 2.08