SCOPe 2.07: Domain d6ecqa1: 6ecq A:2-126

Lineage for d6ecqa1 (6ecq A:2-126)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (2 proteins)
   automatically mapped to Pfam PF00763

6. Protein automated matches [346970] (2 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [366741] (2 PDB entries)

8. Domain d6ecqa1: 6ecq A:2-126 [366742]
   Other proteins in same PDB: d6ecqa2, d6ecqb1, d6ecqb2
   automated match to d1a4ia2
   complexed with lud, nap

Details for d6ecqa1

PDB Entry: 6ecq, 2.7 Å

PDB Description: the human methylenetetrahydrofolate dehydrogenase/cyclohydrolase (fold) complexed with nadp and inhibitor ly345899

PDB Compounds: (A:) methylenetetrahydrofolate dehydrogenase cyclohydrolase

SCOPe Domain Sequences for d6ecqa1:

Sequence; same for both SEQRES and ATOM records:

>d6ecqa1 c.58.1.2 (A:2-126) automated matches {Homo sapiens [TaxId: 9606]}
apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
kdvdg

Timeline for d6ecqa1:

• d6ecqa1 is new in SCOPe 2.07-stable
  
• d6ecqa1 appears in the current release, SCOPe 2.08