Lineage for d6ecqa1 (6ecq A:2-126)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498096Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2498097Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2498288Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (2 proteins)
    automatically mapped to Pfam PF00763
  6. 2498308Protein automated matches [346970] (2 species)
    not a true protein
  7. 2498322Species Homo sapiens [TaxId:9606] [366741] (2 PDB entries)
  8. 2498324Domain d6ecqa1: 6ecq A:2-126 [366742]
    Other proteins in same PDB: d6ecqa2, d6ecqb1, d6ecqb2
    automated match to d1a4ia2
    complexed with lud, nap

Details for d6ecqa1

PDB Entry: 6ecq (more details), 2.7 Å

PDB Description: the human methylenetetrahydrofolate dehydrogenase/cyclohydrolase (fold) complexed with nadp and inhibitor ly345899
PDB Compounds: (A:) methylenetetrahydrofolate dehydrogenase cyclohydrolase

SCOPe Domain Sequences for d6ecqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ecqa1 c.58.1.2 (A:2-126) automated matches {Homo sapiens [TaxId: 9606]}
apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
kdvdg

SCOPe Domain Coordinates for d6ecqa1:

Click to download the PDB-style file with coordinates for d6ecqa1.
(The format of our PDB-style files is described here.)

Timeline for d6ecqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ecqa2