Lineage for d6giaa_ (6gia A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. Protein Pentaerythritol tetranirate reductase [63900] (1 species)
  7. Species Enterobacter cloacae [TaxId:550] [63901] (33 PDB entries)
    Uniprot P71278
  8. Domain d6giaa_: 6gia A: [366485]
    automated match to d1gwja_
    complexed with act, fmn; mutant

    has additional insertions and/or extensions that are not grouped together

Details for d6giaa_

PDB Entry: 6gia (more details), 1.7000000000000002 Å

PDB Description: crystal structure of pentaerythritol tetranitrate reductase (petnr) mutant i107a
PDB Compounds: (A:) Pentaerythritol tetranitrate reductase

SCOPe Domain Sequences for d6giaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6giaa_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]}
eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrashssiqpggqapvsa
salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga
ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyp
sl

SCOPe Domain Coordinates for d6giaa_ are not available.

Timeline for d6giaa_: