Lineage for d6giaa_ (6gia A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2436513Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2436963Protein automated matches [190228] (21 species)
    not a true protein
  7. 2436964Species Enterobacter cloacae [TaxId:550] [366482] (4 PDB entries)
  8. 2436968Domain d6giaa_: 6gia A: [366485]
    automated match to d1gwja_
    complexed with act, fmn; mutant

Details for d6giaa_

PDB Entry: 6gia (more details), 1.7 Å

PDB Description: crystal structure of pentaerythritol tetranitrate reductase (petnr) mutant i107a
PDB Compounds: (A:) Pentaerythritol tetranitrate reductase

SCOPe Domain Sequences for d6giaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6giaa_ c.1.4.1 (A:) automated matches {Enterobacter cloacae [TaxId: 550]}
eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrashssiqpggqapvsa
salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga
ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyp
sl

SCOPe Domain Coordinates for d6giaa_:

Click to download the PDB-style file with coordinates for d6giaa_.
(The format of our PDB-style files is described here.)

Timeline for d6giaa_: