SCOPe 2.07: Domain d6fy4c_: 6fy4 C:

Lineage for d6fy4c_ (6fy4 C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein automated matches [190235] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187003] (8 PDB entries)

8. Domain d6fy4c_: 6fy4 C: [366450]
   automated match to d5ea2a_
   complexed with eaw, fad

Details for d6fy4c_

PDB Entry: 6fy4, 2.76 Å

PDB Description: structure of human nad(p) h:quinone oxidoreductase in complex with n- (2-bromophenyl)pyrrolidine-1-sulfonamide

PDB Compounds: (C:) nad(p)h dehydrogenase [quinone] 1

SCOPe Domain Sequences for d6fy4c_:

Sequence; same for both SEQRES and ATOM records:

>d6fy4c_ c.23.5.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkdp
anfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfig
efaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgfq
vlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkkev
qdeeknkkfglsvghhlgksiptdnqikar

Timeline for d6fy4c_:

• d6fy4c_ is new in SCOPe 2.07-stable
  
• d6fy4c_ appears in the current release, SCOPe 2.08