Lineage for d6fy4d_ (6fy4 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2464786Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 2464991Protein automated matches [190235] (2 species)
    not a true protein
  7. 2464992Species Human (Homo sapiens) [TaxId:9606] [187003] (8 PDB entries)
  8. 2465018Domain d6fy4d_: 6fy4 D: [366440]
    automated match to d5ea2a_
    complexed with eaw, fad

Details for d6fy4d_

PDB Entry: 6fy4 (more details), 2.76 Å

PDB Description: structure of human nad(p) h:quinone oxidoreductase in complex with n- (2-bromophenyl)pyrrolidine-1-sulfonamide
PDB Compounds: (D:) nad(p)h dehydrogenase [quinone] 1

SCOPe Domain Sequences for d6fy4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fy4d_ c.23.5.3 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkdp
anfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfig
efaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgfq
vlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkkev
qdeeknkkfglsvghhlgksiptdnqikar

SCOPe Domain Coordinates for d6fy4d_:

Click to download the PDB-style file with coordinates for d6fy4d_.
(The format of our PDB-style files is described here.)

Timeline for d6fy4d_: