SCOP 1.63: Domain d1f6sb_: 1f6s B:

Lineage for d1f6sb_ (1f6s B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Cow (Bos taurus) [TaxId:9913] [53980] (3 PDB entries)

8. Domain d1f6sb_: 1f6s B: [36613]

Details for d1f6sb_

PDB Entry: 1f6s, 2.2 Å

PDB Description: crystal structure of bovine alpha-lactalbumin

SCOP Domain Sequences for d1f6sb_:

Sequence; same for both SEQRES and ATOM records:

>d1f6sb_ d.2.1.2 (B:) alpha-Lactalbumin {Cow (Bos taurus)}
eqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnkiw
ckddqnphssnicniscdkfldddltddimcvkkildkvginywlahkalcsekldqwlc
e

Timeline for d1f6sb_:

• d1f6sb_ first appeared (with stable ids) in SCOP 1.55
  
• d1f6sb_ appears in SCOP 1.61
  
• d1f6sb_ appears in SCOP 1.65
  
• d1f6sb_ appears in the current release, SCOPe 2.08