Lineage for d1fkva_ (1fkv A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2924220Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 2924239Species Goat (Capra hircus) [TaxId:9925] [53979] (5 PDB entries)
  8. 2924243Domain d1fkva_: 1fkv A: [36602]
    complexed with ca

Details for d1fkva_

PDB Entry: 1fkv (more details), 2 Å

PDB Description: recombinant goat alpha-lactalbumin t29i
PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d1fkva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkva_ d.2.1.2 (A:) alpha-Lactalbumin {Goat (Capra hircus) [TaxId: 9925]}
meqltkcevfqklkdlkdyggvslpewvciafhtsgydtqaivqnndsteyglfqinnki
wckddqnphsrnicniscdkfldddltddivcakkildkvginywlahkalcsekldqwl
c

SCOPe Domain Coordinates for d1fkva_:

Click to download the PDB-style file with coordinates for d1fkva_.
(The format of our PDB-style files is described here.)

Timeline for d1fkva_: