Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein alpha-Lactalbumin [53975] (6 species) expressed only in the lactating mammary gland, strongly binds calcium ion |
Species Guinea pig (Cavia porcellus) [TaxId:10141] [53978] (1 PDB entry) |
Domain d1hfxa_: 1hfx A: [36600] complexed with ca |
PDB Entry: 1hfx (more details), 1.9 Å
SCOPe Domain Sequences for d1hfxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfxa_ d.2.1.2 (A:) alpha-Lactalbumin {Guinea pig (Cavia porcellus) [TaxId: 10141]} kqltkcalshelndlagyrditlpewlciifhisgydtqaivknsdhkeyglfqindkdf cessttvqsrnicdiscdklldddltddimcvkkildikgidywlahkplcsdkleqwyc eaq
Timeline for d1hfxa_: