SCOPe 2.05: Domain d1hfxa_: 1hfx A:

Lineage for d1hfxa_ (1hfx A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Guinea pig (Cavia porcellus) [TaxId:10141] [53978] (1 PDB entry)

8. Domain d1hfxa_: 1hfx A: [36600]
   complexed with ca

Details for d1hfxa_

PDB Entry: 1hfx, 1.9 Å

PDB Description: alpha-lactalbumin

PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d1hfxa_:

Sequence; same for both SEQRES and ATOM records:

>d1hfxa_ d.2.1.2 (A:) alpha-Lactalbumin {Guinea pig (Cavia porcellus) [TaxId: 10141]}
kqltkcalshelndlagyrditlpewlciifhisgydtqaivknsdhkeyglfqindkdf
cessttvqsrnicdiscdklldddltddimcvkkildikgidywlahkplcsdkleqwyc
eaq

Timeline for d1hfxa_:

• d1hfxa_ first appeared (with stable ids) in SCOP 1.55, called d1hfx__
  
• d1hfxa_ appears in SCOPe 2.04
  
• d1hfxa_ appears in SCOPe 2.06
  
• d1hfxa_ appears in the current release, SCOPe 2.08