SCOPe 2.07: Domain d6iczq1: 6icz q:3-59

Lineage for d6iczq1 (6icz q:3-59)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.0: automated matches [191345] (1 protein)
   not a true family

6. Protein automated matches [190242] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189860] (11 PDB entries)

8. Domain d6iczq1: 6icz q:3-59 [365884]
   Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq2, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_
   automated match to d3jb9s1
   complexed with atp, gtp, i6p, mg, zn

Details for d6iczq1

PDB Entry: 6icz, 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom

PDB Compounds: (q:) Pre-mRNA-processing factor 19

SCOPe Domain Sequences for d6iczq1:

Sequence; same for both SEQRES and ATOM records:

>d6iczq1 g.44.1.0 (q:3-59) automated matches {Human (Homo sapiens) [TaxId: 9606]}
licsisnevpehpcvspvsnhvyerrliekyiaengtdpinnqplseeqlidikvah

Timeline for d6iczq1:

• d6iczq1 is new in SCOPe 2.07-stable
  
• d6iczq1 appears in the current release, SCOPe 2.08