Lineage for d6iczs_ (6icz S:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416159Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2416160Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2416161Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2416482Protein Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 [141517] (1 species)
  7. 2416483Species Human (Homo sapiens) [TaxId:9606] [141518] (4 PDB entries)
    Uniprot Q9Y3C6 1-166
  8. 2416486Domain d6iczs_: 6icz S: [365968]
    Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_
    automated match to d1xwna1
    complexed with atp, gtp, i6p, mg, zn

Details for d6iczs_

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (S:) peptidyl-prolyl cis-trans isomerase-like 1

SCOPe Domain Sequences for d6iczs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iczs_ b.62.1.1 (S:) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]}
swqppnvyletsmgiivlelywkhapktcknfaelarrgyyngtkfhriikdfmiqggdp
tgtgrggasiygkqfedelhpdlkftgagilamanagpdtngsqffvtlaptqwldgkht
ifgrvcqgigmvnrvgmvetnsqdrpvddvkiikaypsg

SCOPe Domain Coordinates for d6iczs_:

Click to download the PDB-style file with coordinates for d6iczs_.
(The format of our PDB-style files is described here.)

Timeline for d6iczs_: