Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [255552] (2 PDB entries) |
Domain d6mujb_: 6muj B: [365426] automated match to d2q17e_ complexed with ca, cu, dtt, fmt, gly, gol, imd |
PDB Entry: 6muj (more details), 2.25 Å
SCOPe Domain Sequences for d6mujb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mujb_ d.169.1.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 100226]} epgpaarprstrgqvrlpggefamgdafgegypadgetpvhtvrlrpfhidetavtnarf aafvkatghvtdaerfgssavfhlvvaapdadvlgsaagapwwinvrgahwrrpegarsd itgrpnhpvvhvswndatayarwagkrlpteaeweyaargglagrryawgdeltpggrwr cniwqgrfphvntaedghlstapvksyrpnghglwntagnvwewcsdwfsptyyaesptv dphgpgtgaarvlrggsylchdsycnryrvaarssntpdsssgnlgfrcandad
Timeline for d6mujb_:
View in 3D Domains from other chains: (mouse over for more information) d6muja_, d6mujc_, d6mujd_, d6muje_ |