PDB entry 6muj

View 6muj on RCSB PDB site
Description: Formylglycine generating enzyme bound to copper
Class: metal binding protein
Keywords: formylglycine, copper oxidase, metalloenzyme, METAL BINDING PROTEIN
Deposited on 2018-10-23, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formylglycine-generating enzyme
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO7548
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6muja_
  • Chain 'B':
    Compound: Formylglycine-generating enzyme
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO7548
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mujb_
  • Chain 'C':
    Compound: Formylglycine-generating enzyme
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO7548
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mujc_
  • Chain 'D':
    Compound: Formylglycine-generating enzyme
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO7548
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mujd_
  • Chain 'E':
    Compound: Formylglycine-generating enzyme
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO7548
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6muje_
  • Heterogens: CA, CU, IMD, GOL, FMT, GLY, DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mujA (A:)
    gidpftavaapspaaaaepgpaarprstrgqvrlpggefamgdafgegypadgetpvhtv
    rlrpfhidetavtnarfaafvkatghvtdaerfgssavfhlvvaapdadvlgsaagapww
    invrgahwrrpegarsditgrpnhpvvhvswndatayarwagkrlpteaeweyaarggla
    grryawgdeltpggrwrcniwqgrfphvntaedghlstapvksyrpnghglwntagnvwe
    wcsdwfsptyyaesptvdphgpgtgaarvlrggsylchdsycnryrvaarssntpdsssg
    nlgfrcandadltsgsaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mujA (A:)
    arprstrgqvrlpggefamgdafgegypadgetpvhtvrlrpfhidetavtnarfaafvk
    atghvtdaerfgssavfhlvvaapdadvlgsaagapwwinvrgahwrrpegarsditgrp
    nhpvvhvswndatayarwagkrlpteaeweyaargglagrryawgdeltpggrwrcniwq
    grfphvntaedghlstapvksyrpnghglwntagnvwewcsdwfsptyyaesptvdphgp
    gtgaarvlrggsylchdsycnryrvaarssntpdsssgnlgfrcandad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mujB (B:)
    gidpftavaapspaaaaepgpaarprstrgqvrlpggefamgdafgegypadgetpvhtv
    rlrpfhidetavtnarfaafvkatghvtdaerfgssavfhlvvaapdadvlgsaagapww
    invrgahwrrpegarsditgrpnhpvvhvswndatayarwagkrlpteaeweyaarggla
    grryawgdeltpggrwrcniwqgrfphvntaedghlstapvksyrpnghglwntagnvwe
    wcsdwfsptyyaesptvdphgpgtgaarvlrggsylchdsycnryrvaarssntpdsssg
    nlgfrcandadltsgsaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mujB (B:)
    epgpaarprstrgqvrlpggefamgdafgegypadgetpvhtvrlrpfhidetavtnarf
    aafvkatghvtdaerfgssavfhlvvaapdadvlgsaagapwwinvrgahwrrpegarsd
    itgrpnhpvvhvswndatayarwagkrlpteaeweyaargglagrryawgdeltpggrwr
    cniwqgrfphvntaedghlstapvksyrpnghglwntagnvwewcsdwfsptyyaesptv
    dphgpgtgaarvlrggsylchdsycnryrvaarssntpdsssgnlgfrcandad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6mujC (C:)
    gidpftavaapspaaaaepgpaarprstrgqvrlpggefamgdafgegypadgetpvhtv
    rlrpfhidetavtnarfaafvkatghvtdaerfgssavfhlvvaapdadvlgsaagapww
    invrgahwrrpegarsditgrpnhpvvhvswndatayarwagkrlpteaeweyaarggla
    grryawgdeltpggrwrcniwqgrfphvntaedghlstapvksyrpnghglwntagnvwe
    wcsdwfsptyyaesptvdphgpgtgaarvlrggsylchdsycnryrvaarssntpdsssg
    nlgfrcandadltsgsaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mujC (C:)
    arprstrgqvrlpggefamgdafgegypadgetpvhtvrlrpfhidetavtnarfaafvk
    atghvtdaerfgssavfhlvvaapdadvlgsaagapwwinvrgahwrrpegarsditgrp
    nhpvvhvswndatayarwagkrlpteaeweyaargglagrryawgdeltpggrwrcniwq
    grfphvntaedghlstapvksyrpnghglwntagnvwewcsdwfsptyyaesptvdphgp
    gtgaarvlrggsylchdsycnryrvaarssntpdsssgnlgfrcandad
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6mujD (D:)
    gidpftavaapspaaaaepgpaarprstrgqvrlpggefamgdafgegypadgetpvhtv
    rlrpfhidetavtnarfaafvkatghvtdaerfgssavfhlvvaapdadvlgsaagapww
    invrgahwrrpegarsditgrpnhpvvhvswndatayarwagkrlpteaeweyaarggla
    grryawgdeltpggrwrcniwqgrfphvntaedghlstapvksyrpnghglwntagnvwe
    wcsdwfsptyyaesptvdphgpgtgaarvlrggsylchdsycnryrvaarssntpdsssg
    nlgfrcandadltsgsaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mujD (D:)
    aarprstrgqvrlpggefamgdafgegypadgetpvhtvrlrpfhidetavtnarfaafv
    katghvtdaerfgssavfhlvvaapdadvlgsaagapwwinvrgahwrrpegarsditgr
    pnhpvvhvswndatayarwagkrlpteaeweyaargglagrryawgdeltpggrwrcniw
    qgrfphvntaedghlstapvksyrpnghglwntagnvwewcsdwfsptyyaesptvdphg
    pgtgaarvlrggsylchdsycnryrvaarssntpdsssgnlgfrcandadlts
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6mujE (E:)
    gidpftavaapspaaaaepgpaarprstrgqvrlpggefamgdafgegypadgetpvhtv
    rlrpfhidetavtnarfaafvkatghvtdaerfgssavfhlvvaapdadvlgsaagapww
    invrgahwrrpegarsditgrpnhpvvhvswndatayarwagkrlpteaeweyaarggla
    grryawgdeltpggrwrcniwqgrfphvntaedghlstapvksyrpnghglwntagnvwe
    wcsdwfsptyyaesptvdphgpgtgaarvlrggsylchdsycnryrvaarssntpdsssg
    nlgfrcandadltsgsaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mujE (E:)
    prstrgqvrlpggefamgdafgegypadgetpvhtvrlrpfhidetavtnarfaafvkat
    ghvtdaerfgssavfhlvvaapdadvlgsaagapwwinvrgahwrrpegarsditgrpnh
    pvvhvswndatayarwagkrlpteaeweyaargglagrryawgdeltpggrwrcniwqgr
    fphvntaedghlstapvksyrpnghglwntagnvwewcsdwfsptyyaesptvdphgpgt
    gaarvlrggsylchdsycnryrvaarssntpdsssgnlgfrcandadltsg