Lineage for d6muje_ (6muj E:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (19 species)
    not a true protein
  7. 2560031Species Streptomyces coelicolor [TaxId:100226] [255552] (2 PDB entries)
  8. 3065371Domain d6muje_: 6muj E: [365433]
    automated match to d2q17e_
    complexed with ca, cu, dtt, fmt, gly, gol, imd

Details for d6muje_

PDB Entry: 6muj (more details), 2.25 Å

PDB Description: formylglycine generating enzyme bound to copper
PDB Compounds: (E:) Formylglycine-generating enzyme

SCOPe Domain Sequences for d6muje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6muje_ d.169.1.0 (E:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
prstrgqvrlpggefamgdafgegypadgetpvhtvrlrpfhidetavtnarfaafvkat
ghvtdaerfgssavfhlvvaapdadvlgsaagapwwinvrgahwrrpegarsditgrpnh
pvvhvswndatayarwagkrlpteaeweyaargglagrryawgdeltpggrwrcniwqgr
fphvntaedghlstapvksyrpnghglwntagnvwewcsdwfsptyyaesptvdphgpgt
gaarvlrggsylchdsycnryrvaarssntpdsssgnlgfrcandadltsg

SCOPe Domain Coordinates for d6muje_:

Click to download the PDB-style file with coordinates for d6muje_.
(The format of our PDB-style files is described here.)

Timeline for d6muje_:

  • d6muje_ is new in SCOPe 2.07-stable