Lineage for d6hoja_ (6hoj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933199Domain d6hoja_: 6hoj A: [365327]
    automated match to d3waoa_
    complexed with edo, so4

Details for d6hoja_

PDB Entry: 6hoj (more details), 1.51 Å

PDB Description: structure of beclin1 lir motif bound to gabarap
PDB Compounds: (A:) Beclin-1,Gamma-aminobutyric acid receptor-associated protein

SCOPe Domain Sequences for d6hoja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hoja_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sftligeasdgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkk
ylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyia
ysde

SCOPe Domain Coordinates for d6hoja_:

Click to download the PDB-style file with coordinates for d6hoja_.
(The format of our PDB-style files is described here.)

Timeline for d6hoja_: