Lineage for d6hojb_ (6hoj B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. Protein automated matches [190233] (31 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187090] (155 PDB entries)
  8. Domain d6hojb_: 6hoj B: [365308]
    automated match to d3waoa_
    complexed with edo, so4

Details for d6hojb_

PDB Entry: 6hoj (more details), 1.51 Å

PDB Description: structure of beclin1 lir motif bound to gabarap
PDB Compounds: (B:) Beclin-1,Gamma-aminobutyric acid receptor-associated protein

SCOPe Domain Sequences for d6hojb_:

Sequence, based on SEQRES records: (download)

>d6hojb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsftligeasdgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkk
kylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyi
aysde

Sequence, based on observed residues (ATOM records): (download)

>d6hojb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsftligeassmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkky
lvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiay
sde

SCOPe Domain Coordinates for d6hojb_ are not available.

Timeline for d6hojb_:

Domains from other chains:
(mouse over for more information)
d6hoja_, d6hojc_