Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
Protein automated matches [190312] (14 species) not a true protein |
Domain d6a50b2: 6a50 B:182-341 [365000] Other proteins in same PDB: d6a50a1, d6a50a3, d6a50a4, d6a50b1, d6a50b3, d6a50b4 automated match to d1q6za1 complexed with mg, tpp |
PDB Entry: 6a50 (more details), 1.8 Å
SCOPe Domain Sequences for d6a50b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a50b2 c.31.1.0 (B:182-341) automated matches {Pseudomonas putida [TaxId: 303]} svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryvfydpgqylkpgtrlisvtcd pleaarapmgdaivadigamasalanlveessrqlptaap
Timeline for d6a50b2:
View in 3D Domains from other chains: (mouse over for more information) d6a50a1, d6a50a2, d6a50a3, d6a50a4 |