SCOPe 2.08: Domain d6a50b2: 6a50 B:182-341

Lineage for d6a50b2 (6a50 B:182-341)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (14 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [255602] (2 PDB entries)

8. Domain d6a50b2: 6a50 B:182-341 [365000]
   Other proteins in same PDB: d6a50a1, d6a50a3, d6a50a4, d6a50b1, d6a50b3, d6a50b4
   automated match to d1q6za1
   complexed with mg, tpp

Details for d6a50b2

PDB Entry: 6a50, 1.8 Å

PDB Description: structure of benzoylformate decarboxylases in complex with cofactor tpp

PDB Compounds: (B:) benzoylformate decarboxylases

SCOPe Domain Sequences for d6a50b2:

Sequence; same for both SEQRES and ATOM records:

>d6a50b2 c.31.1.0 (B:182-341) automated matches {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryvfydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

Timeline for d6a50b2:

• d6a50b2 first appeared in SCOPe 2.07