Lineage for d6a50b2 (6a50 B:182-341)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2863020Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2863021Protein automated matches [190312] (14 species)
    not a true protein
  7. 2863114Species Pseudomonas putida [TaxId:303] [255602] (2 PDB entries)
  8. 2863116Domain d6a50b2: 6a50 B:182-341 [365000]
    Other proteins in same PDB: d6a50a1, d6a50a3, d6a50a4, d6a50b1, d6a50b3, d6a50b4
    automated match to d1q6za1
    complexed with mg, tpp

Details for d6a50b2

PDB Entry: 6a50 (more details), 1.8 Å

PDB Description: structure of benzoylformate decarboxylases in complex with cofactor tpp
PDB Compounds: (B:) benzoylformate decarboxylases

SCOPe Domain Sequences for d6a50b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a50b2 c.31.1.0 (B:182-341) automated matches {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryvfydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

SCOPe Domain Coordinates for d6a50b2:

Click to download the PDB-style file with coordinates for d6a50b2.
(The format of our PDB-style files is described here.)

Timeline for d6a50b2: