Lineage for d6fzya1 (6fzy A:231-505)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2335636Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2335637Species Human (Homo sapiens) [TaxId:9606] [48525] (132 PDB entries)
    Uniprot P37231 232-505
  8. 3064745Domain d6fzya1: 6fzy A:231-505 [364807]
    Other proteins in same PDB: d6fzya2, d6fzyb2
    automated match to d3prga_
    mutant

Details for d6fzya1

PDB Entry: 6fzy (more details), 3.1 Å

PDB Description: ppar mutant
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d6fzya1:

Sequence, based on SEQRES records: (download)

>d6fzya1 a.123.1.1 (A:231-505) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
kfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygv
heiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldds
dlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdl
rqivmehvqllqvikktetdmslhpllqeiykdly

Sequence, based on observed residues (ATOM records): (download)

>d6fzya1 a.123.1.1 (A:231-505) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
plqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiyt
mlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifi
aviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivme
hvqllqvikktetdmslhpllqeiykdly

SCOPe Domain Coordinates for d6fzya1:

Click to download the PDB-style file with coordinates for d6fzya1.
(The format of our PDB-style files is described here.)

Timeline for d6fzya1:

  • d6fzya1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-14

View in 3D
Domains from same chain:
(mouse over for more information)
d6fzya2