PDB entry 6fzy

View 6fzy on RCSB PDB site
Description: PPAR mutant
Class: transcription
Keywords: nuclear receptor, TRANSCRIPTION
Deposited on 2018-03-15, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (4-278)
      • expression tag (3)
      • engineered mutation (248)
    Domains in SCOPe 2.07: d6fzya1, d6fzya2
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (4-278)
      • expression tag (3)
      • engineered mutation (248)
    Domains in SCOPe 2.07: d6fzyb1, d6fzyb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fzyA (A:)
    gshmqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmg
    edkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtll
    kygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnale
    lddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqk
    mtdlrqivmehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fzyA (A:)
    mqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
    iplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiy
    tmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaif
    iaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivm
    ehvqllqvikktetdmslhpllqeiykdly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fzyB (B:)
    gshmqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmg
    edkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtll
    kygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnale
    lddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqk
    mtdlrqivmehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fzyB (B:)
    mqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
    ilqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiyt
    mlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifi
    aviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivme
    hvqllqvikktetdmslhpllqeiykdly