SCOPe 2.08: Domain d2xaub2: 2xau B:271-454

Lineage for d2xaub2 (2xau B:271-454)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (15 PDB entries)

8. Domain d2xaub2: 2xau B:271-454 [364731]
   Other proteins in same PDB: d2xaua3, d2xaua4, d2xaua5, d2xaub3, d2xaub4, d2xaub5
   automated match to d3kx2a2
   protein/RNA complex; complexed with act, adp, gol, mg, ni

Details for d2xaub2

PDB Entry: 2xau, 1.9 Å

PDB Description: crystal structure of the prp43p deah-box rna helicase in complex with adp

PDB Compounds: (B:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d2xaub2:

Sequence; same for both SEQRES and ATOM records:

>d2xaub2 c.37.1.0 (B:271-454) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
typvelyytpefqrdyldsairtvlqihateeagdillfltgedeiedavrkislegdql
vreegcgplsvyplygslpphqqqrifepapeshngrpgrkvvistniaetsltidgivy
vvdpgfskqkvynprirvesllvspiskasaqqragragrtrpgkcfrlyteeafqkeli
eqsy

Timeline for d2xaub2:

• d2xaub2 first appeared in SCOPe 2.07