Lineage for d2xaub2 (2xau B:271-454)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871683Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (15 PDB entries)
  8. 2871692Domain d2xaub2: 2xau B:271-454 [364731]
    Other proteins in same PDB: d2xaua3, d2xaua4, d2xaua5, d2xaub3, d2xaub4, d2xaub5
    automated match to d3kx2a2
    protein/RNA complex; complexed with act, adp, gol, mg, ni

Details for d2xaub2

PDB Entry: 2xau (more details), 1.9 Å

PDB Description: crystal structure of the prp43p deah-box rna helicase in complex with adp
PDB Compounds: (B:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d2xaub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xaub2 c.37.1.0 (B:271-454) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
typvelyytpefqrdyldsairtvlqihateeagdillfltgedeiedavrkislegdql
vreegcgplsvyplygslpphqqqrifepapeshngrpgrkvvistniaetsltidgivy
vvdpgfskqkvynprirvesllvspiskasaqqragragrtrpgkcfrlyteeafqkeli
eqsy

SCOPe Domain Coordinates for d2xaub2:

Click to download the PDB-style file with coordinates for d2xaub2.
(The format of our PDB-style files is described here.)

Timeline for d2xaub2: