SCOPe 2.08: Domain d2xaub3: 2xau B:455-520

Lineage for d2xaub3 (2xau B:455-520)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [364720] (1 PDB entry)

8. Domain d2xaub3: 2xau B:455-520 [364732]
   Other proteins in same PDB: d2xaua1, d2xaua2, d2xaua4, d2xaua5, d2xaub1, d2xaub2, d2xaub4, d2xaub5
   automated match to d3kx2a3
   protein/RNA complex; complexed with act, adp, gol, mg, ni

Details for d2xaub3

PDB Entry: 2xau, 1.9 Å

PDB Description: crystal structure of the prp43p deah-box rna helicase in complex with adp

PDB Compounds: (B:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d2xaub3:

Sequence; same for both SEQRES and ATOM records:

>d2xaub3 a.4.5.0 (B:455-520) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
peilrsnlsstvlelkklgiddlvhfdfmdppapetmmraleelnylaclddegnltplg
rlasqf

Timeline for d2xaub3:

• d2xaub3 first appeared in SCOPe 2.07