Lineage for d6qhcb_ (6qhc B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405212Protein Kallikrein 6 [74974] (1 species)
  7. 2405213Species Human (Homo sapiens) [TaxId:9606] [74975] (9 PDB entries)
  8. 2405223Domain d6qhcb_: 6qhc B: [364712]
    automated match to d1gvla_
    complexed with 135, dms, gol

Details for d6qhcb_

PDB Entry: 6qhc (more details), 1.87 Å

PDB Description: crystal structure of human kallikrein 6 in complex with gsk358180b
PDB Compounds: (B:) Kallikrein-6

SCOPe Domain Sequences for d6qhcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qhcb_ b.47.1.2 (B:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]}
lvhggpcdktshpyqaalytsghllcggvlihplwvltaahckkpnlqvflgkhnlgqqe
ssqeqssvvravihpdydaashdqdimllrlarpaklseliqplplerdcsaqttschil
gwgktadgdfpdtiqcayihlvsreecehaypgqitqnmlcagdekygkdscqgdsggpl
vcgdhlrglvswgnipcgskekpgvytnvcrytnwiqktiqa

SCOPe Domain Coordinates for d6qhcb_:

Click to download the PDB-style file with coordinates for d6qhcb_.
(The format of our PDB-style files is described here.)

Timeline for d6qhcb_: