![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Kallikrein 6 [74974] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74975] (9 PDB entries) |
![]() | Domain d6qhcb_: 6qhc B: [364712] automated match to d1gvla_ complexed with 135, dms, gol |
PDB Entry: 6qhc (more details), 1.87 Å
SCOPe Domain Sequences for d6qhcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qhcb_ b.47.1.2 (B:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} lvhggpcdktshpyqaalytsghllcggvlihplwvltaahckkpnlqvflgkhnlgqqe ssqeqssvvravihpdydaashdqdimllrlarpaklseliqplplerdcsaqttschil gwgktadgdfpdtiqcayihlvsreecehaypgqitqnmlcagdekygkdscqgdsggpl vcgdhlrglvswgnipcgskekpgvytnvcrytnwiqktiqa
Timeline for d6qhcb_: