SCOPe 2.07: Domain d6qhca_: 6qhc A:

Lineage for d6qhca_ (6qhc A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Kallikrein 6 [74974] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74975] (9 PDB entries)

8. Domain d6qhca_: 6qhc A: [364709]
   automated match to d1gvla_
   complexed with 135, dms, gol

Details for d6qhca_

PDB Entry: 6qhc, 1.87 Å

PDB Description: crystal structure of human kallikrein 6 in complex with gsk358180b

PDB Compounds: (A:) Kallikrein-6

SCOPe Domain Sequences for d6qhca_:

Sequence; same for both SEQRES and ATOM records:

>d6qhca_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]}
lvhggpcdktshpyqaalytsghllcggvlihplwvltaahckkpnlqvflgkhnlgqqe
ssqeqssvvravihpdydaashdqdimllrlarpaklseliqplplerdcsaqttschil
gwgktadgdfpdtiqcayihlvsreecehaypgqitqnmlcagdekygkdscqgdsggpl
vcgdhlrglvswgnipcgskekpgvytnvcrytnwiqktiqa

Timeline for d6qhca_:

• d6qhca_ is new in SCOPe 2.07-stable
  
• d6qhca_ appears in the current release, SCOPe 2.08