SCOPe 2.08: Domain d6ifwa_: 6ifw A:

Lineage for d6ifwa_ (6ifw A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (87 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [354711] (4 PDB entries)

8. Domain d6ifwa_: 6ifw A: [364239]
   automated match to d3uzua_

Details for d6ifwa_

PDB Entry: 6ifw, 2.95 Å

PDB Description: crystal structure of chimeric construct of ksga with loop 1 from erm

PDB Compounds: (A:) Ribosomal RNA small subunit methyltransferase A

SCOPe Domain Sequences for d6ifwa_:

Sequence; same for both SEQRES and ATOM records:

>d6ifwa_ c.66.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
nflidtnilnrivdhaevtektgvieigpgigalteqlakrakkvvafeidqrllpilkd
tlspyenvtvihqdvlkadvksvieeqfqdcdeimvvanlpyyvttpiimklleehlplk
givvmlqkevaermaadpsskeygslsiavqfyteaktvmivpktvfvpqpnvdsavirl
ilrdgpavdvenesfffqlikasfaqrrktllnnlvnnlpegkaqkstieqvleetnidg
krrgeslsieefaalsnglykalf

Timeline for d6ifwa_:

• d6ifwa_ first appeared in SCOPe 2.07