Lineage for d6ifwa_ (6ifw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894514Species Bacillus subtilis [TaxId:224308] [354711] (4 PDB entries)
  8. 2894520Domain d6ifwa_: 6ifw A: [364239]
    automated match to d3uzua_

Details for d6ifwa_

PDB Entry: 6ifw (more details), 2.95 Å

PDB Description: crystal structure of chimeric construct of ksga with loop 1 from erm
PDB Compounds: (A:) Ribosomal RNA small subunit methyltransferase A

SCOPe Domain Sequences for d6ifwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ifwa_ c.66.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
nflidtnilnrivdhaevtektgvieigpgigalteqlakrakkvvafeidqrllpilkd
tlspyenvtvihqdvlkadvksvieeqfqdcdeimvvanlpyyvttpiimklleehlplk
givvmlqkevaermaadpsskeygslsiavqfyteaktvmivpktvfvpqpnvdsavirl
ilrdgpavdvenesfffqlikasfaqrrktllnnlvnnlpegkaqkstieqvleetnidg
krrgeslsieefaalsnglykalf

SCOPe Domain Coordinates for d6ifwa_:

Click to download the PDB-style file with coordinates for d6ifwa_.
(The format of our PDB-style files is described here.)

Timeline for d6ifwa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6ifwb_